PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC6210_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SRS
Protein Properties Length: 229aa    MW: 24195.5 Da    PI: 6.2926
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC6210_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702221.51.8e-6811576154
      DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrel.....kskkqsalsstkls 92 
                 ++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrerq+qla + +k++++a       +    +r+ ++          sal++ +++
  RrC6210_p3   1 MNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERQAQLAGLPTKRSRDAssgcgddD---DDREGDEnggqgGGGGGSALACIRVV 96 
                 68**************************************************999998888766765431...22222223444456778999****99 PP

      DUF702  93 saeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 +a+s+  +e s+lP+evs +avfrc+rvss++d++ee+aYqtavsigGhvfkGiLydqG+++
  RrC6210_p3  97 NASSS-GFESSHLPPEVSLPAVFRCMRVSSIEDEDEEYAYQTAVSIGGHVFKGILYDQGPSD 157
                 99765.99***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.1E-621156IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016236.1E-28244IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.0E-25107155IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MNCQDCGNQA KKDCPHMRCR TCCKSRGFDC QTHVKSTWVP AAKRRERQAQ LAGLPTKRSR  60
DASSGCGDDD DDREGDENGG QGGGGGGSAL ACIRVVNASS SGFESSHLPP EVSLPAVFRC  120
MRVSSIEDED EEYAYQTAVS IGGHVFKGIL YDQGPSDDHR YSSSPAAAAV ETSQHHLNLL  180
ASASSVATTT AVTASNINNA SIDHSSVYTA APINSFITPA TSFFASPRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052680.0GU205268.1 Brassica rapa subsp. pekinensis short internode related sequence 7 (SRS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149464.11e-139PREDICTED: protein SHI RELATED SEQUENCE 7
RefseqXP_009149465.11e-139PREDICTED: protein SHI RELATED SEQUENCE 7
SwissprotQ9FXH71e-110SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLD2KC771e-139D2KC77_BRARP; Short internode related sequence 7
STRINGBra025768.1-P1e-139(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-95SHI-related sequence 7